| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Enolase [54828] (9 species) |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (9 PDB entries) Uniprot P09104 |
| Domain d3uccb1: 3ucc B:1-139 [217284] Other proteins in same PDB: d3ucca2, d3uccb2 automated match to d1pdza2 complexed with 2pg, mg, trs |
PDB Entry: 3ucc (more details), 1.5 Å
SCOPe Domain Sequences for d3uccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uccb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
siqkiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg
vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka
gaaerelplyrhiaqlagn
Timeline for d3uccb1: