![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins) C-terminal domain is beta/alpha-barrel |
![]() | Protein Enolase [54828] (10 species) |
![]() | Species Human (Homo sapiens), gamma isoform [TaxId:9606] [110936] (15 PDB entries) Uniprot P09104 |
![]() | Domain d3uccb1: 3ucc B:1-139 [217284] Other proteins in same PDB: d3ucca2, d3uccb2 automated match to d1pdza2 complexed with 2pg, mg, trs |
PDB Entry: 3ucc (more details), 1.5 Å
SCOPe Domain Sequences for d3uccb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3uccb1 d.54.1.1 (B:1-139) Enolase {Human (Homo sapiens), gamma isoform [TaxId: 9606]} siqkiwareildsrgnptvevdlytakglfraavpsgastgiyealelrdgdkqrylgkg vlkavdhinstiapalissglsvveqekldnlmleldgtenkskfganailgvslavcka gaaerelplyrhiaqlagn
Timeline for d3uccb1: