Lineage for d3u8uf_ (3u8u F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224401Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2224424Protein DNA repair endonuclease Hap1 [56223] (1 species)
    Major apurinic/apyrimidinic endonuclease APE1
  7. 2224425Species Human (Homo sapiens) [TaxId:9606] [56224] (11 PDB entries)
  8. 2224435Domain d3u8uf_: 3u8u F: [217225]
    automated match to d1hd7a_
    complexed with cl, mg

Details for d3u8uf_

PDB Entry: 3u8u (more details), 2.15 Å

PDB Description: Crystal structure of Human Apurinic/Apyridinimic Endonuclease, Ape1 in a new crystal form
PDB Compounds: (F:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d3u8uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8uf_ d.151.1.1 (F:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

SCOPe Domain Coordinates for d3u8uf_:

Click to download the PDB-style file with coordinates for d3u8uf_.
(The format of our PDB-style files is described here.)

Timeline for d3u8uf_: