SCOPe 2.03: Domain d3u8uf_: 3u8u F:

Lineage for d3u8uf_ (3u8u F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein DNA repair endonuclease Hap1 [56223] (1 species)
   Major apurinic/apyrimidinic endonuclease APE1

7. Species Human (Homo sapiens) [TaxId:9606] [56224] (8 PDB entries)

8. Domain d3u8uf_: 3u8u F: [217225]
   automated match to d1hd7a_
   complexed with cl, mg

Details for d3u8uf_

PDB Entry: 3u8u, 2.15 Å

PDB Description: Crystal structure of Human Apurinic/Apyridinimic Endonuclease, Ape1 in a new crystal form

PDB Compounds: (F:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d3u8uf_:

Sequence; same for both SEQRES and ATOM records:

>d3u8uf_ d.151.1.1 (F:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d3u8uf_:

• d3u8uf_ is new in SCOPe 2.03-stable
  
• d3u8uf_ appears in SCOPe 2.04
  
• d3u8uf_ appears in the current release, SCOPe 2.08