Lineage for d3u4lp_ (3u4l P:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970039Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) (S)
    alpha-beta(2)-alpha-beta(5)-alpha
  5. 2970040Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
    automatically mapped to Pfam PF00235
  6. 2970041Protein Profilin (actin-binding protein) [55772] (8 species)
  7. 2970055Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries)
  8. 2970058Domain d3u4lp_: 3u4l P: [217195]
    Other proteins in same PDB: d3u4la1, d3u4la2
    automated match to d1pnea_
    complexed with atp, ca

Details for d3u4lp_

PDB Entry: 3u4l (more details), 2.4 Å

PDB Description: Cryocooled bovine profilin:actin crystal structure to 2.4 A
PDB Compounds: (P:) Profilin-1

SCOPe Domain Sequences for d3u4lp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u4lp_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

SCOPe Domain Coordinates for d3u4lp_:

Click to download the PDB-style file with coordinates for d3u4lp_.
(The format of our PDB-style files is described here.)

Timeline for d3u4lp_: