Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein Profilin (actin-binding protein) [55772] (8 species) |
Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries) |
Domain d3u4lp_: 3u4l P: [217195] Other proteins in same PDB: d3u4la1, d3u4la2 automated match to d1pnea_ complexed with atp, ca |
PDB Entry: 3u4l (more details), 2.4 Å
SCOPe Domain Sequences for d3u4lp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u4lp_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg gminkkcyemashlrrsqy
Timeline for d3u4lp_: