Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226802] (3 PDB entries) |
Domain d3u4la1: 3u4l A:6-146 [217193] Other proteins in same PDB: d3u4la2, d3u4lp_ automated match to d1d4xa1 complexed with atp, ca |
PDB Entry: 3u4l (more details), 2.4 Å
SCOPe Domain Sequences for d3u4la1:
Sequence, based on SEQRES records: (download)
>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]} aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe tfntpamyvaiqavlslyasg
>d3u4la1 c.55.1.0 (A:6-146) automated matches {Cow (Bos taurus) [TaxId: 9913]} aalvvdngsgmckagfagddapravfpsivgdsyvgdeaqskrgikypiehgivtnwddm ekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamyvaiqavlsl yasg
Timeline for d3u4la1: