| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [225259] (3 PDB entries) |
| Domain d3u4la2: 3u4l A:147-375 [217194] Other proteins in same PDB: d3u4la1, d3u4lp_ automated match to d1d4xa2 complexed with atp, ca |
PDB Entry: 3u4l (more details), 2.4 Å
SCOPe Domain Sequences for d3u4la2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u4la2 c.55.1.1 (A:147-375) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf
Timeline for d3u4la2: