SCOPe 2.07: Domain d3u4la2: 3u4l A:147-375

Lineage for d3u4la2 (3u4l A:147-375)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225259] (3 PDB entries)

8. Domain d3u4la2: 3u4l A:147-375 [217194]
   Other proteins in same PDB: d3u4la1, d3u4lp_
   automated match to d1d4xa2
   complexed with atp, ca

Details for d3u4la2

PDB Entry: 3u4l, 2.4 Å

PDB Description: Cryocooled bovine profilin:actin crystal structure to 2.4 A

PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d3u4la2:

Sequence; same for both SEQRES and ATOM records:

>d3u4la2 c.55.1.1 (A:147-375) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d3u4la2:

• d3u4la2 first appeared in SCOPe 2.03
  
• d3u4la2 appears in SCOPe 2.06
  
• d3u4la2 appears in the current release, SCOPe 2.08