Lineage for d3u49a1 (3u49 A:2-259)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094430Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)
  8. 2094435Domain d3u49a1: 3u49 A:2-259 [217179]
    Other proteins in same PDB: d3u49a2, d3u49b2
    automated match to d1g0na_

Details for d3u49a1

PDB Entry: 3u49 (more details), 1.75 Å

PDB Description: Crystal structure of YwfH, NADPH dependent reductase involved in Bacilysin biosynthesis
PDB Compounds: (A:) Bacilysin biosynthesis oxidoreductase ywfH

SCOPe Domain Sequences for d3u49a1:

Sequence, based on SEQRES records: (download)

>d3u49a1 c.2.1.0 (A:2-259) automated matches {Bacillus subtilis [TaxId: 1423]}
skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
lnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipmkrvgsaeetaalaaflaseea
syitgqqisadggsmksi

Sequence, based on observed residues (ATOM records): (download)

>d3u49a1 c.2.1.0 (A:2-259) automated matches {Bacillus subtilis [TaxId: 1423]}
skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
lnpgfiatdryhqfvenvmkknsisgipmkrvgsaeetaalaaflaseeasyitgqqisa
dggsmksi

SCOPe Domain Coordinates for d3u49a1:

Click to download the PDB-style file with coordinates for d3u49a1.
(The format of our PDB-style files is described here.)

Timeline for d3u49a1: