PDB entry 3u49

View 3u49 on RCSB PDB site
Description: Crystal structure of YwfH, NADPH dependent reductase involved in Bacilysin biosynthesis
Class: oxidoreductase
Keywords: NADPH binding motif, Rossmann fold, Short chain Dehydrogenase, reductase, SDR super family, Oxidoreductase, Bacilysin biosynthesis
Deposited on 2011-10-07, released 2013-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bacilysin biosynthesis oxidoreductase ywfH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37680, ipa-86r, ywfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39644 (Start-278)
      • cloning artifact (279)
    Domains in SCOPe 2.07: d3u49a1, d3u49a2
  • Chain 'B':
    Compound: Bacilysin biosynthesis oxidoreductase ywfH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37680, ipa-86r, ywfH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39644 (Start-278)
      • cloning artifact (279-280)
    Domains in SCOPe 2.07: d3u49b1, d3u49b2
  • Chain 'C':
    Compound: Bacilysin biosynthesis oxidoreductase ywfH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37680, ipa-86r, ywfH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u49c_
  • Chain 'D':
    Compound: Bacilysin biosynthesis oxidoreductase ywfH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU37680, ipa-86r, ywfH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3u49d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3u49A (A:)
    mgsshhhhhhssglvprgshmskrtafvmgasqgigkaialkladqhfslvinsrnldni
    esvkedilakhpeasvivlagdmsdqhtragifqkiesqcgrldvlinnipggapdtfdn
    cniedmtatftqktvayidaikrasslmkqnefgriinivgnlwkepganmftnsmmnaa
    linasknisiqlaphnitvnclnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipm
    krvgsaeetaalaaflaseeasyitgqqisadggsmksile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u49A (A:)
    skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
    dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
    krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
    lnpgfiatdryhqfvenvmkknsisgipmkrvgsaeetaalaaflaseeasyitgqqisa
    dggsmksil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3u49B (B:)
    mgsshhhhhhssglvprgshmskrtafvmgasqgigkaialkladqhfslvinsrnldni
    esvkedilakhpeasvivlagdmsdqhtragifqkiesqcgrldvlinnipggapdtfdn
    cniedmtatftqktvayidaikrasslmkqnefgriinivgnlwkepganmftnsmmnaa
    linasknisiqlaphnitvnclnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipm
    krvgsaeetaalaaflaseeasyitgqqisadggsmksile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u49B (B:)
    krtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlagd
    msdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidaik
    rasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvncl
    npgfiatdryhqfvenvmkknsiskqkipmkrvgsaeetaalaaflaseeasyitgqqis
    adggsmksile
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3u49C (C:)
    mgsshhhhhhssglvprgshmskrtafvmgasqgigkaialkladqhfslvinsrnldni
    esvkedilakhpeasvivlagdmsdqhtragifqkiesqcgrldvlinnipggapdtfdn
    cniedmtatftqktvayidaikrasslmkqnefgriinivgnlwkepganmftnsmmnaa
    linasknisiqlaphnitvnclnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipm
    krvgsaeetaalaaflaseeasyitgqqisadggsmksile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u49C (C:)
    skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
    dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
    krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
    lnpgfiatdryhqfvenvmkknsiskqkasgipmkrvgsaeetaalaaflaseeasyitg
    qqisadggsmks
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3u49D (D:)
    mgsshhhhhhssglvprgshmskrtafvmgasqgigkaialkladqhfslvinsrnldni
    esvkedilakhpeasvivlagdmsdqhtragifqkiesqcgrldvlinnipggapdtfdn
    cniedmtatftqktvayidaikrasslmkqnefgriinivgnlwkepganmftnsmmnaa
    linasknisiqlaphnitvnclnpgfiatdryhqfvenvmkknsiskqkaeeqiasgipm
    krvgsaeetaalaaflaseeasyitgqqisadggsmksile
    

    Sequence, based on observed residues (ATOM records): (download)
    >3u49D (D:)
    skrtafvmgasqgigkaialkladqhfslvinsrnldniesvkedilakhpeasvivlag
    dmsdqhtragifqkiesqcgrldvlinnipggapdtfdncniedmtatftqktvayidai
    krasslmkqnefgriinivgnlwkepganmftnsmmnaalinasknisiqlaphnitvnc
    lnpgfiatdryhqfvenvmkknsmkrvgsaeetaalaaflaseeasyitgqqisadggsm
    ks