SCOP 1.73: Domain d1tita_: 1tit A:

Lineage for d1tita_ (1tit A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Twitchin [49174] (2 species)

7. Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries)

8. Domain d1tita_: 1tit A: [21716]

Details for d1tita_

PDB Entry: 1tit

PDB Description: titin, ig repeat 27, nmr, minimized average structure

PDB Compounds: (A:) titin, i27

SCOP Domain Sequences for d1tita_:

Sequence; same for both SEQRES and ATOM records:

>d1tita_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]}
lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
hncqlgmtgevsfqaanaksaanlkvkel

Timeline for d1tita_:

• d1tita_ first appeared (with stable ids) in SCOP 1.55, called d1tit__
  
• d1tita_ was called d1tit__ in SCOP 1.71
  
• d1tita_ appears in SCOP 1.75
  
• d1tita_ appears in the current release, SCOPe 2.08