Lineage for d1tita_ (1tit A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (39 proteins) 
Protein Twitchin [49174] (2 species) 
Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries) 
Domain d1tita_: 1tit A: [21716]
Details for d1tita_
PDB Entry: 1tit (more details)
PDB Description: titin, ig repeat 27, nmr, minimized average structure
PDB Compounds: (A:) titin, i27SCOPe Domain Sequences for d1tita_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tita_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]}
lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
hncqlgmtgevsfqaanaksaanlkvkel
SCOPe Domain Coordinates for d1tita_:
Click to download the PDB-style file with coordinates for d1tita_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tita_:
- d1tita_ first appeared (with stable ids) in SCOP 1.55, called d1tit__
- d1tita_ appears in SCOPe 2.07
View in 3D