Lineage for d1tit__ (1tit -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 9408Family b.1.1.4: I set domains [49159] (21 proteins)
  6. 9560Protein Twitchin [49174] (2 species)
  7. 9561Species Human (Homo sapiens), Ig repeat 27 [TaxId:9606] [49176] (2 PDB entries)
  8. 9563Domain d1tit__: 1tit - [21716]

Details for d1tit__

PDB Entry: 1tit (more details)

PDB Description: titin, ig repeat 27, nmr, minimized average structure

SCOP Domain Sequences for d1tit__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tit__ b.1.1.4 (-) Twitchin {Human (Homo sapiens), Ig repeat 27}
lievekplygvevfvgetahfeielsepdvhgqwklkgqpltaspdceiiedgkkhilil
hncqlgmtgevsfqaanaksaanlkvkel

SCOP Domain Coordinates for d1tit__:

Click to download the PDB-style file with coordinates for d1tit__.
(The format of our PDB-style files is described here.)

Timeline for d1tit__: