Lineage for d3tz3c1 (3tz3 C:1494-1814)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1353895Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1353896Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1354508Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (7 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. 1354670Protein automated matches [226926] (3 species)
    not a true protein
  7. 1354696Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (4 PDB entries)
  8. 1354719Domain d3tz3c1: 3tz3 C:1494-1814 [217110]
    automated match to d1uyrb1
    complexed with b36

Details for d3tz3c1

PDB Entry: 3tz3 (more details), 2.7 Å

PDB Description: crystal structure of the humanized carboxyltransferase domain of yeast acetyl-coa caroxylase in complex with compound 2
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d3tz3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tz3c1 c.14.1.4 (C:1494-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
qpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengeltev
erepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteyark
rgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdken
svltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcrsv
gigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlggtqimynngvshlta
vddlagvekivewmsyvpakr

SCOPe Domain Coordinates for d3tz3c1:

Click to download the PDB-style file with coordinates for d3tz3c1.
(The format of our PDB-style files is described here.)

Timeline for d3tz3c1: