![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
![]() | Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
![]() | Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
![]() | Protein automated matches [226926] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226234] (6 PDB entries) |
![]() | Domain d3tz3c1: 3tz3 C:1494-1814 [217110] automated match to d1uyrb1 complexed with b36 |
PDB Entry: 3tz3 (more details), 2.7 Å
SCOPe Domain Sequences for d3tz3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tz3c1 c.14.1.4 (C:1494-1814) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} qpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengeltev erepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteyark rgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdken svltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcrsv gigaylvrlgqraiqvegqpiiltgasalnkvlgrevytsnlqlggtqimynngvshlta vddlagvekivewmsyvpakr
Timeline for d3tz3c1:
![]() Domains from other chains: (mouse over for more information) d3tz3a1, d3tz3a2, d3tz3b1, d3tz3b2 |