SCOPe 2.06: Domain d3tyfd2: 3tyf D:119-247

Lineage for d3tyfd2 (3tyf D:119-247)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [224854] (1 PDB entry)

8. Domain d3tyfd2: 3tyf D:119-247 [217093]
   Other proteins in same PDB: d3tyfa1, d3tyfb1, d3tyfc1, d3tyfd1
   automated match to d1ktke2
   complexed with gol

Details for d3tyfd2

PDB Entry: 3tyf, 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR

PDB Compounds: (D:) iNKT Cell Receptor Beta Chain

SCOPe Domain Sequences for d3tyfd2:

Sequence; same for both SEQRES and ATOM records:

>d3tyfd2 b.1.1.2 (D:119-247) automated matches {Escherichia coli [TaxId: 562]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d3tyfd2:

• d3tyfd2 first appeared in SCOPe 2.03
  
• d3tyfd2 appears in SCOPe 2.05
  
• d3tyfd2 appears in SCOPe 2.07
  
• d3tyfd2 appears in the current release, SCOPe 2.08