Lineage for d3tyfd2 (3tyf D:119-247)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294272Species Escherichia coli [TaxId:562] [224854] (11 PDB entries)
  8. 1294291Domain d3tyfd2: 3tyf D:119-247 [217093]
    Other proteins in same PDB: d3tyfa1, d3tyfb1, d3tyfc1, d3tyfd1
    automated match to d1ktke2
    complexed with gol

Details for d3tyfd2

PDB Entry: 3tyf (more details), 2.81 Å

PDB Description: Crystal structure of a CD1d-lysophosphatidylcholine reactive iNKT TCR
PDB Compounds: (D:) iNKT Cell Receptor Beta Chain

SCOPe Domain Sequences for d3tyfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyfd2 b.1.1.2 (D:119-247) automated matches {Escherichia coli [TaxId: 562]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d3tyfd2:

Click to download the PDB-style file with coordinates for d3tyfd2.
(The format of our PDB-style files is described here.)

Timeline for d3tyfd2: