![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (12 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [224854] (11 PDB entries) |
![]() | Domain d3tyfd2: 3tyf D:119-247 [217093] Other proteins in same PDB: d3tyfa1, d3tyfb1, d3tyfc1, d3tyfd1 automated match to d1ktke2 complexed with gol |
PDB Entry: 3tyf (more details), 2.81 Å
SCOPe Domain Sequences for d3tyfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tyfd2 b.1.1.2 (D:119-247) automated matches {Escherichia coli [TaxId: 562]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d3tyfd2: