Lineage for d3ttna_ (3ttn A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1390576Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1390577Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1391676Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1391677Protein automated matches [190039] (57 species)
    not a true protein
  7. 1392006Species Pseudomonas aeruginosa [TaxId:287] [195692] (2 PDB entries)
  8. 1392007Domain d3ttna_: 3ttn A: [217028]
    automated match to d3ttlb_
    complexed with spd

Details for d3ttna_

PDB Entry: 3ttn (more details), 2 Å

PDB Description: Crystal structures of polyamine receptors SpuD and SpuE from Pseudomonas aeruginosa
PDB Compounds: (A:) Polyamine transport protein

SCOPe Domain Sequences for d3ttna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ttna_ c.94.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
slhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsghsgydivvpsnnflg
kqiqagafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkev
lgdqpidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaee
vltkvrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkeg
anlwfdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsds
eevyppqavldklyvsavlpakvlrlqtrtwtrik

SCOPe Domain Coordinates for d3ttna_:

Click to download the PDB-style file with coordinates for d3ttna_.
(The format of our PDB-style files is described here.)

Timeline for d3ttna_: