Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (57 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [195692] (2 PDB entries) |
Domain d3ttnb_: 3ttn B: [217029] automated match to d3ttlb_ complexed with spd |
PDB Entry: 3ttn (more details), 2 Å
SCOPe Domain Sequences for d3ttnb_:
Sequence, based on SEQRES records: (download)
>d3ttnb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsghsgydivvpsnnflgk qiqagafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkevl gdqpidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaeev ltkvrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkega nlwfdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsdse evyppqavldklyvsavlpakvlrlqtrtwtri
>d3ttnb_ c.94.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lhiynwtdyiapttlkdftkesgidvsydvfdsnetlegklvsgydivvpsnnflgkqiq agafqkldksklpnwknldpallkqlevsdpgnqyavpylwgtngigynvakvkevlgdq pidswailfepenmkklakcgvafmdsgdemlpaalnylgldpnthdpkdykkaeevltk vrpyvsyfhsskyisdlangnicvafgysgdvfqaaaraeeagkgidiqyvipkeganlw fdlmaipadakaadnayafidyllrpeviakvsdyvgyanaipgarplmdksvsdseevy ppqavldklyvsavlpakvlrlqtrtwtri
Timeline for d3ttnb_: