Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.0: automated matches [227270] (1 protein) not a true family |
Protein automated matches [227070] (5 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [226215] (1 PDB entry) |
Domain d3tqmc_: 3tqm C: [216980] automated match to d3v2ey_ complexed with so4 |
PDB Entry: 3tqm (more details), 2.45 Å
SCOPe Domain Sequences for d3tqmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqmc_ d.204.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 777]} mhiqmtgqgvdispalreltekklhriqpcrdeisnihiifhinklkkivdanvklpgst inaqaesddmyktvdllmhkletqlskykakkg
Timeline for d3tqmc_: