Lineage for d3tqmc_ (3tqm C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238670Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 2238671Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 2238688Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 2238689Protein automated matches [227070] (5 species)
    not a true protein
  7. 2238690Species Coxiella burnetii [TaxId:777] [226215] (1 PDB entry)
  8. 2238693Domain d3tqmc_: 3tqm C: [216980]
    automated match to d3v2ey_
    complexed with so4

Details for d3tqmc_

PDB Entry: 3tqm (more details), 2.45 Å

PDB Description: structure of an ribosomal subunit interface protein from coxiella burnetii
PDB Compounds: (C:) Ribosome-associated factor Y

SCOPe Domain Sequences for d3tqmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqmc_ d.204.1.0 (C:) automated matches {Coxiella burnetii [TaxId: 777]}
mhiqmtgqgvdispalreltekklhriqpcrdeisnihiifhinklkkivdanvklpgst
inaqaesddmyktvdllmhkletqlskykakkg

SCOPe Domain Coordinates for d3tqmc_:

Click to download the PDB-style file with coordinates for d3tqmc_.
(The format of our PDB-style files is described here.)

Timeline for d3tqmc_: