Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) automatically mapped to Pfam PF02482 |
Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (2 proteins) |
Protein automated matches [195300] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [195301] (2 PDB entries) |
Domain d3v2ey_: 3v2e Y: [195302] complexed with mg, zn complexed with mg, zn |
PDB Entry: 3v2e (more details), 2.7 Å
SCOPe Domain Sequences for d3v2ey_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v2ey_ d.204.1.1 (Y:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvlv asgkhedmytainelinklerqlnklqhkgearr
Timeline for d3v2ey_: