Lineage for d3v2ey_ (3v2e Y:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238670Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 2238671Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 2238672Family d.204.1.1: Ribosome binding protein Y (YfiA homologue) [69755] (2 proteins)
  6. 2238684Protein automated matches [195300] (1 species)
    not a true protein
  7. 2238685Species Escherichia coli K-12 [TaxId:83333] [195301] (2 PDB entries)
  8. 2238687Domain d3v2ey_: 3v2e Y: [195302]
    complexed with mg, zn
    complexed with mg, zn

Details for d3v2ey_

PDB Entry: 3v2e (more details), 2.7 Å

PDB Description: Crystal structure of YfiA bound to the 70S ribosome. This PDB entry contains coordinates for the 30S subunit with bound YfiA of the 2nd ribosome in the ASU
PDB Compounds: (Y:) Ribosome-associated inhibitor A

SCOPe Domain Sequences for d3v2ey_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v2ey_ d.204.1.1 (Y:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mnitskqmeitpairqhvadrlaklekwqthlinphiilskepqgfvadatintpngvlv
asgkhedmytainelinklerqlnklqhkgearr

SCOPe Domain Coordinates for d3v2ey_:

Click to download the PDB-style file with coordinates for d3v2ey_.
(The format of our PDB-style files is described here.)

Timeline for d3v2ey_: