Lineage for d3tp1a_ (3tp1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560843Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1560844Protein automated matches [191182] (11 species)
    not a true protein
  7. 1560985Species Mason-pfizer monkey virus [TaxId:11855] [225168] (16 PDB entries)
  8. 1560988Domain d3tp1a_: 3tp1 A: [216946]
    automated match to d1q5hc_
    complexed with dup, mg

Details for d3tp1a_

PDB Entry: 3tp1 (more details), 1.6 Å

PDB Description: crystal structure of the precatalytic m-pmv dutpase - substrate (dupnpp) complex
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotido hydrolase

SCOPe Domain Sequences for d3tp1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tp1a_ b.85.4.0 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]}
qkqpiskltratpgsagldlcstshtvltpemgpqalstgiygplppntfglilgrssit
mkglqvypgvidndytgeikimakavnnivtvsqgnriaqlillplietdnkvq

SCOPe Domain Coordinates for d3tp1a_:

Click to download the PDB-style file with coordinates for d3tp1a_.
(The format of our PDB-style files is described here.)

Timeline for d3tp1a_: