SCOPe 2.04: Domain d3tfsa2: 3tfs A:92-148

Lineage for d3tfsa2 (3tfs A:92-148)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (143 PDB entries)

8. Domain d3tfsa2: 3tfs A:92-148 [216799]
   Other proteins in same PDB: d3tfsa1, d3tfsa3
   automated match to d1tv9a2
   protein/DNA complex; complexed with cl, fha, mg, na

Details for d3tfsa2

PDB Entry: 3tfs, 2 Å

PDB Description: Ternary complex structure of DNA polymerase beta with a gapped DNA substrate and a, b dAMP(CFH)PP in the active site: Stereoselective binding of (S) isomer

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3tfsa2:

Sequence; same for both SEQRES and ATOM records:

>d3tfsa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d3tfsa2:

• d3tfsa2 first appeared in SCOPe 2.03
  
• d3tfsa2 appears in SCOPe 2.05
  
• d3tfsa2 appears in the current release, SCOPe 2.08