Lineage for d3tfsa2 (3tfs A:92-148)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272870Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272871Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1272872Protein DNA polymerase beta [81579] (2 species)
  7. 1272873Species Human (Homo sapiens) [TaxId:9606] [81575] (132 PDB entries)
  8. 1272887Domain d3tfsa2: 3tfs A:92-148 [216799]
    Other proteins in same PDB: d3tfsa1, d3tfsa3
    automated match to d1tv9a2
    protein/DNA complex; complexed with cl, fha, mg, na

Details for d3tfsa2

PDB Entry: 3tfs (more details), 2 Å

PDB Description: Ternary complex structure of DNA polymerase beta with a gapped DNA substrate and a, b dAMP(CFH)PP in the active site: Stereoselective binding of (S) isomer
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3tfsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tfsa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d3tfsa2:

Click to download the PDB-style file with coordinates for d3tfsa2.
(The format of our PDB-style files is described here.)

Timeline for d3tfsa2: