SCOP 1.57: Domain d1cid_2: 1cid 106-177

Lineage for d1cid_2 (1cid 106-177)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (7 proteins)

6. Protein CD4 [49149] (2 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [49151] (1 PDB entry)

8. Domain d1cid_2: 1cid 106-177 [21679]
   Other proteins in same PDB: d1cid_1

Details for d1cid_2

PDB Entry: 1cid, 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

SCOP Domain Sequences for d1cid_2:

Sequence; same for both SEQRES and ATOM records:

>d1cid_2 b.1.1.3 (106-177) CD4 {Rat (Rattus rattus)}
vmkvtqpdsntltcevmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllse
geevkmdskiqv

Timeline for d1cid_2:

• d1cid_2 first appeared (with stable ids) in SCOP 1.55
  
• d1cid_2 appears in SCOP 1.59
  
• d1cid_2 appears in the current release, SCOPe 2.08, called d1cida2