SCOPe 2.08: Domain d1cida2: 1cid A:106-177

Lineage for d1cida2 (1cid A:106-177)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein CD4 C2-set domains [49149] (2 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [49151] (1 PDB entry)

8. Domain d1cida2: 1cid A:106-177 [21679]
   Other proteins in same PDB: d1cida1
   domain 4
   complexed with so4

Details for d1cida2

PDB Entry: 1cid, 2.8 Å

PDB Description: crystal structure of domains 3 & 4 of rat cd4 and their relationship to the nh2-terminal domains

PDB Compounds: (A:) t cell surface glycoprotein cd4

SCOPe Domain Sequences for d1cida2:

Sequence; same for both SEQRES and ATOM records:

>d1cida2 b.1.1.3 (A:106-177) CD4 C2-set domains {Rat (Rattus rattus) [TaxId: 10117]}
vmkvtqpdsntltcevmgptspkmrlilkqenqearvsrqekviqvqapeagvwqcllse
geevkmdskiqv

Timeline for d1cida2:

• d1cida2 first appeared (with stable ids) in SCOP 1.55, called d1cid_2
  
• d1cida2 appears in SCOPe 2.07