SCOPe 2.07: Domain d3t7cb_: 3t7c B:

Lineage for d3t7cb_ (3t7c B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [189589] (5 PDB entries)

8. Domain d3t7cb_: 3t7c B: [216698]
   automated match to d3uwrd_
   complexed with nad

Details for d3t7cb_

PDB Entry: 3t7c, 1.95 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium avium bound to nad

PDB Compounds: (B:) carveol dehydrogenase

SCOPe Domain Sequences for d3t7cb_:

Sequence; same for both SEQRES and ATOM records:

>d3t7cb_ c.2.1.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
agkvegkvafitgaargqgrshaitlaregadiiaidvckqldgvklpmstpddlaetvr
qvealgrriiasqvdvrdfdamqaavddgvtqlgrldivlanaalasegtrlnrmdpktw
rdmidvnlngawitarvaiphimagkrggsivftssigglrgaenignyiaskhglhglm
rtmalelgprnirvnivcpssvatpmllneptyrmfrpdlenptvedfqvasrqmhvlpi
pyvepadisnailflvsddaryitgvslpvdggallk

Timeline for d3t7cb_:

• d3t7cb_ first appeared in SCOPe 2.03
  
• d3t7cb_ appears in SCOPe 2.06
  
• d3t7cb_ appears in the current release, SCOPe 2.08