Lineage for d3t60a_ (3t60 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560651Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1560805Protein automated matches [190798] (8 species)
    not a true protein
  7. 1560831Species Plasmodium falciparum [TaxId:36329] [188061] (4 PDB entries)
  8. 1560838Domain d3t60a_: 3t60 A: [216690]
    automated match to d2y8ca_
    complexed with dua, gol

Details for d3t60a_

PDB Entry: 3t60 (more details), 2.4 Å

PDB Description: 5'-Diphenyl Nucleoside Inhibitors of Plasmodium falciparum dUTPase
PDB Compounds: (A:) Deoxyuridine 5'-triphosphate nucleotidohydrolase, putative

SCOPe Domain Sequences for d3t60a_:

Sequence, based on SEQRES records: (download)

>d3t60a_ b.85.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremyknhkthhegdsgldlfivkdevlkpksttfvklgikaialqyks
nyyykceksenkkkdddksnivntsfllfprssisktplrlansiglidagyrgeiiaal
dntsdqeyhikkndklvqlvsftgeplsfelveeldetsrgeggfg

Sequence, based on observed residues (ATOM records): (download)

>d3t60a_ b.85.4.1 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mhlkivclsdevremykndsgldlfivkdevlkpksttfvklgikaialqyksnyynivn
tsfllfprssisktplrlansiglidagyrgeiiaaldntsdqeyhikkndklvqlvsft
geplsfelveeldetsrgeggfg

SCOPe Domain Coordinates for d3t60a_:

Click to download the PDB-style file with coordinates for d3t60a_.
(The format of our PDB-style files is described here.)

Timeline for d3t60a_: