Lineage for d3sqgg1 (3sqg G:2-283)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561884Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2562016Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2562017Protein automated matches [227074] (5 species)
    not a true protein
  7. 2562044Species Uncultured archaeon [TaxId:115547] [226262] (1 PDB entry)
  8. 2562049Domain d3sqgg1: 3sqg G:2-283 [216512]
    Other proteins in same PDB: d3sqga2, d3sqgb2, d3sqgd2, d3sqge2, d3sqgg2, d3sqgh2
    automated match to d1e6ya2
    complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7

Details for d3sqgg1

PDB Entry: 3sqg (more details), 2.1 Å

PDB Description: crystal structure of a methyl-coenzyme m reductase purified from black sea mats
PDB Compounds: (G:) Methyl coenzyme M reductase, alpha subunit

SCOPe Domain Sequences for d3sqgg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqgg1 d.58.31.0 (G:2-283) automated matches {Uncultured archaeon [TaxId: 115547]}
pyndiqhnflkamsdkfaekpestatefytyggiaqkggmrkrefiaeaskivdsrvnst
paynpdagmpqgqrylmpymmnhtdimvnaddlhwinnaamqqawddmkrgivlglddah
gllearlgkevtpdtisnymevlnhalpggaviqehmvetkpmlvndsyakifsgdddlv
dsvdrrfildinkefaagydkpgeqadqlkdaigkkiwqilwmptvvarqtdggtmfrwv
gmqvgmtminayklcagesvtgefayyakhaavvqlsnympv

SCOPe Domain Coordinates for d3sqgg1:

Click to download the PDB-style file with coordinates for d3sqgg1.
(The format of our PDB-style files is described here.)

Timeline for d3sqgg1: