Lineage for d3sqgd2 (3sqg D:284-579)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332765Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2332766Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2332848Family a.89.1.0: automated matches [227272] (1 protein)
    not a true family
  6. 2332849Protein automated matches [227075] (5 species)
    not a true protein
  7. 2332867Species Uncultured archaeon [TaxId:115547] [226263] (1 PDB entry)
  8. 2332870Domain d3sqgd2: 3sqg D:284-579 [216509]
    Other proteins in same PDB: d3sqga1, d3sqgb1, d3sqgd1, d3sqge1, d3sqgg1, d3sqgh1
    automated match to d1e6ya1
    complexed with 1pe, ca, cl, com, gol, m43, p6g, pge, so4, tp7

Details for d3sqgd2

PDB Entry: 3sqg (more details), 2.1 Å

PDB Description: crystal structure of a methyl-coenzyme m reductase purified from black sea mats
PDB Compounds: (D:) Methyl coenzyme M reductase, alpha subunit

SCOPe Domain Sequences for d3sqgd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqgd2 a.89.1.0 (D:284-579) automated matches {Uncultured archaeon [TaxId: 115547]}
krarshnepggmplginadstrspalfpndpiraelesiavaamvydqlwfgtymsggvg
ftqyasatytdniledfcykgceigldyaggkmasikgdklnmdileeiiraendyaltq
yeayptvaeshfggsvraccaaagcgsavacatglaqpalsawslsmlghyervgrlgff
gydlqdqctacgsysyqsdegmpfemrgvnypnyamnvghqsayaglvagahsanhdawv
lsplwkvafsdrdlpfdrgyvtreyglganreytkvagerdliiaghygrepgakl

SCOPe Domain Coordinates for d3sqgd2:

Click to download the PDB-style file with coordinates for d3sqgd2.
(The format of our PDB-style files is described here.)

Timeline for d3sqgd2: