SCOPe 2.08: Domain d3slcb1: 3slc B:3-199

Lineage for d3slcb1 (3slc B:3-199)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)

8. Domain d3slcb1: 3slc B:3-199 [216463]
   Other proteins in same PDB: d3slca3
   automated match to d1g99a1
   complexed with edo

Details for d3slcb1

PDB Entry: 3slc, 2.7 Å

PDB Description: Crystal structure of apo form of acetate kinase (AckA) from Salmonella typhimurium

PDB Compounds: (B:) acetate kinase

SCOPe Domain Sequences for d3slcb1:

Sequence; same for both SEQRES and ATOM records:

>d3slcb1 c.55.1.0 (B:3-199) automated matches {Salmonella enterica [TaxId: 90371]}
sklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgagaa
hsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfapl
hnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrrygah
gtshfyvtqeaakmlnk

Timeline for d3slcb1:

• d3slcb1 first appeared in SCOPe 2.03
  
• d3slcb1 appears in SCOPe 2.07