Lineage for d3slcc1 (3slc C:3-199)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885527Species Salmonella enterica [TaxId:90371] [226450] (2 PDB entries)
  8. 2885536Domain d3slcc1: 3slc C:3-199 [216465]
    Other proteins in same PDB: d3slca3
    automated match to d1g99a1
    complexed with edo

Details for d3slcc1

PDB Entry: 3slc (more details), 2.7 Å

PDB Description: Crystal structure of apo form of acetate kinase (AckA) from Salmonella typhimurium
PDB Compounds: (C:) acetate kinase

SCOPe Domain Sequences for d3slcc1:

Sequence, based on SEQRES records: (download)

>d3slcc1 c.55.1.0 (C:3-199) automated matches {Salmonella enterica [TaxId: 90371]}
sklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaalgagaa
hsealnfivntilaqkpelsaqltaighrivhggekytssvvidesviqgikdsasfapl
hnpahligiaealksfpqlkdknvavfdtafhqtmpeesylyalpyslykehgvrrygah
gtshfyvtqeaakmlnk

Sequence, based on observed residues (ATOM records): (download)

>d3slcc1 c.55.1.0 (C:3-199) automated matches {Salmonella enterica [TaxId: 90371]}
sklvlvlncgssslkfaiidavngdeylsglaecfhlpearikwkmdgskqeaallaqkp
elsaqltaighrivhggekytssvvidesviqgikdsasfaplhnpahligiaealksfp
qlkdknvavfdtafhqtmpeesylyalpyslykehgvrrygahgtshfyvtqeaakmlnk

SCOPe Domain Coordinates for d3slcc1:

Click to download the PDB-style file with coordinates for d3slcc1.
(The format of our PDB-style files is described here.)

Timeline for d3slcc1: