Lineage for d1iaoa1 (1iao A:83-178)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 933034Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 933084Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
    probably orthologous to the human HLA-DQ group
  8. 933114Domain d1iaoa1: 1iao A:83-178 [21641]
    Other proteins in same PDB: d1iaoa2, d1iaob1, d1iaob2
    complexed with nag

Details for d1iaoa1

PDB Entry: 1iao (more details), 2.6 Å

PDB Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
PDB Compounds: (A:) MHC class II I-ad

SCOPe Domain Sequences for d1iaoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaoa1 b.1.1.2 (A:83-178) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
tneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvtdgvyetsflvnrd
hsfhklsyltfipsdddiydckvehwgleepvlkhw

SCOPe Domain Coordinates for d1iaoa1:

Click to download the PDB-style file with coordinates for d1iaoa1.
(The format of our PDB-style files is described here.)

Timeline for d1iaoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iaoa2