![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (20 species) not a true protein |
![]() | Species Pseudomonas stutzeri [TaxId:316] [226186] (3 PDB entries) |
![]() | Domain d3sbpb2: 3sbp B:508-638 [216281] Other proteins in same PDB: d3sbpa1, d3sbpb1, d3sbpc1, d3sbpd1, d3sbpe1, d3sbpf1, d3sbpg1, d3sbph1 automated match to d1qnia1 complexed with ca, cl, cua, cuk, imd, k |
PDB Entry: 3sbp (more details), 2.1 Å
SCOPe Domain Sequences for d3sbpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sbpb2 b.6.1.0 (B:508-638) automated matches {Pseudomonas stutzeri [TaxId: 316]} kiwdrndpffaptvemakkdginldtdnkvirdgnkvrvymtsmapafgvqeftvkqgde vtvtitnidqiedvshgfvvvnhgvsmeispqqtssitfvadkpglhwyycswfchalhm emvgrmmvepa
Timeline for d3sbpb2: