Lineage for d3s7na2 (3s7n A:135-323)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1427772Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1427834Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1427835Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 1427884Protein automated matches [227076] (2 species)
    not a true protein
  7. 1427885Species Deinococcus radiodurans [TaxId:1299] [226274] (4 PDB entries)
  8. 1427889Domain d3s7na2: 3s7n A:135-323 [216229]
    Other proteins in same PDB: d3s7na1
    automated match to d1ztua1
    complexed with lbv

Details for d3s7na2

PDB Entry: 3s7n (more details), 2.45 Å

PDB Description: Crystal Structure of the alternate His 207 conformation of the Infrared Fluorescent D207H variant of Deinococcus Bacteriophytochrome chromophore binding domain at 2.45 angstrom resolution
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3s7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s7na2 d.110.2.1 (A:135-323) automated matches {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkeale

SCOPe Domain Coordinates for d3s7na2:

Click to download the PDB-style file with coordinates for d3s7na2.
(The format of our PDB-style files is described here.)

Timeline for d3s7na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3s7na1