![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.1: GAF domain [55782] (8 proteins) |
![]() | Protein Bacteriophytochrome BphP [160661] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries) Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325 |
![]() | Domain d3s7na2: 3s7n A:135-321 [216229] Other proteins in same PDB: d3s7na1, d3s7na3 automated match to d1ztua1 complexed with lbv |
PDB Entry: 3s7n (more details), 2.45 Å
SCOPe Domain Sequences for d3s7na2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s7na2 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg lhaflghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl qvqvkea
Timeline for d3s7na2: