Lineage for d3s7na2 (3s7n A:135-321)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970141Protein Bacteriophytochrome BphP [160661] (3 species)
  7. 2970142Species Deinococcus radiodurans [TaxId:1299] [160663] (7 PDB entries)
    Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325
  8. 2970147Domain d3s7na2: 3s7n A:135-321 [216229]
    Other proteins in same PDB: d3s7na1, d3s7na3
    automated match to d1ztua1
    complexed with lbv

Details for d3s7na2

PDB Entry: 3s7n (more details), 2.45 Å

PDB Description: Crystal Structure of the alternate His 207 conformation of the Infrared Fluorescent D207H variant of Deinococcus Bacteriophytochrome chromophore binding domain at 2.45 angstrom resolution
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3s7na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s7na2 d.110.2.1 (A:135-321) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
tgphalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreg
lhaflghrfpashipaqaralytrhllrltadtraaavpldpvlnpqtnaptplggavlr
atspmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleslgrllsl
qvqvkea

SCOPe Domain Coordinates for d3s7na2:

Click to download the PDB-style file with coordinates for d3s7na2.
(The format of our PDB-style files is described here.)

Timeline for d3s7na2: