Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.1: GAF domain [55782] (8 proteins) |
Protein Bacteriophytochrome BphP [160661] (2 species) |
Species Deinococcus radiodurans [TaxId:1299] [160663] (3 PDB entries) Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325 |
Domain d1ztua1: 1ztu A:137-325 [146024] Other proteins in same PDB: d1ztua2 complexed with bla |
PDB Entry: 1ztu (more details), 2.5 Å
SCOPe Domain Sequences for d1ztua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ztua1 d.110.2.1 (A:137-325) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} phalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh aflghrfpasdipaqaralytrhllrltadtraaavpldpvlntqtnaptplggavlrat spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrllslqv qvkeahhhh
Timeline for d1ztua1: