Lineage for d1ztua1 (1ztu A:137-325)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1215666Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1215667Family d.110.2.1: GAF domain [55782] (7 proteins)
  6. 1215672Protein Bacteriophytochrome BphP [160661] (2 species)
  7. 1215673Species Deinococcus radiodurans [TaxId:1299] [160663] (3 PDB entries)
    Uniprot Q9RZA4 135-321! Uniprot Q9RZA4 137-325
  8. 1215676Domain d1ztua1: 1ztu A:137-325 [146024]
    Other proteins in same PDB: d1ztua2
    complexed with bla

Details for d1ztua1

PDB Entry: 1ztu (more details), 2.5 Å

PDB Description: structure of the chromophore binding domain of bacterial phytochrome
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d1ztua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztua1 d.110.2.1 (A:137-325) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
phalrnamfalesapnlralaevatqtvreltgfdrvmlykfapdatgeviaearreglh
aflghrfpasdipaqaralytrhllrltadtraaavpldpvlntqtnaptplggavlrat
spmhmqylrnmgvgsslsvsvvvggqlwgliachhqtpyvlppdlrttleylgrllslqv
qvkeahhhh

SCOPe Domain Coordinates for d1ztua1:

Click to download the PDB-style file with coordinates for d1ztua1.
(The format of our PDB-style files is described here.)

Timeline for d1ztua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztua2