Lineage for d1ztua2 (1ztu A:5-130)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1215605Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1215775Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 1215935Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 1215936Protein Bacteriophytochrome BphP [160672] (2 species)
  7. 1215937Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries)
    Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130
  8. 1215940Domain d1ztua2: 1ztu A:5-130 [146025]
    Other proteins in same PDB: d1ztua1
    complexed with bla

Details for d1ztua2

PDB Entry: 1ztu (more details), 2.5 Å

PDB Description: structure of the chromophore binding domain of bacterial phytochrome
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d1ztua2:

Sequence, based on SEQRES records: (download)

>d1ztua2 d.110.3.9 (A:5-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq
eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellil
efepte

Sequence, based on observed residues (ATOM records): (download)

>d1ztua2 d.110.3.9 (A:5-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]}
plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq
eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpghlsltvhrvgellilef
epte

SCOPe Domain Coordinates for d1ztua2:

Click to download the PDB-style file with coordinates for d1ztua2.
(The format of our PDB-style files is described here.)

Timeline for d1ztua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ztua1