![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
![]() | Protein Bacteriophytochrome BphP [160672] (2 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [160673] (3 PDB entries) Uniprot Q9RZA4 4-130! Uniprot Q9RZA4 5-130 |
![]() | Domain d1ztua2: 1ztu A:5-130 [146025] Other proteins in same PDB: d1ztua1 complexed with bla |
PDB Entry: 1ztu (more details), 2.5 Å
SCOPe Domain Sequences for d1ztua2:
Sequence, based on SEQRES records: (download)
>d1ztua2 d.110.3.9 (A:5-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvgellil efepte
>d1ztua2 d.110.3.9 (A:5-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 1299]} plpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaatflgq eptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpghlsltvhrvgellilef epte
Timeline for d1ztua2: