Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
Protein RPB11 [64312] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224934] (1 PDB entry) |
Domain d3s14k_: 3s14 K: [216153] Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14l_ automated match to d1twfk_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 3s14 (more details), 2.85 Å
SCOPe Domain Sequences for d3s14k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3s14k_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d3s14k_: