SCOPe 2.05: Domain d3s14c2: 3s14 C:42-172

Lineage for d3s14c2 (3s14 C:42-172)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
   unusual fold; contains a left-handed beta-alpha-beta unit

4. Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)
   automatically mapped to Pfam PF01000

5. Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)

6. Protein RPB3 [64462] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224943] (1 PDB entry)

8. Domain d3s14c2: 3s14 C:42-172 [216145]
   Other proteins in same PDB: d3s14a_, d3s14b_, d3s14c1, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
   automated match to d1twfc2
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14c2

PDB Entry: 3s14, 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna

PDB Compounds: (C:) DNA-directed RNA polymerase II subunit RPB3

SCOPe Domain Sequences for d3s14c2:

Sequence; same for both SEQRES and ATOM records:

>d3s14c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

Timeline for d3s14c2:

• d3s14c2 first appeared in SCOPe 2.03
  
• d3s14c2 appears in SCOPe 2.04
  
• d3s14c2 appears in SCOPe 2.06
  
• d3s14c2 appears in the current release, SCOPe 2.08