Lineage for d3s14b_ (3s14 B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1954356Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1954357Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1954358Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1954359Protein RBP2 [64491] (2 species)
  7. 1954389Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224945] (1 PDB entry)
  8. 1954390Domain d3s14b_: 3s14 B: [216143]
    Other proteins in same PDB: d3s14a_, d3s14c1, d3s14c2, d3s14e1, d3s14e2, d3s14f_, d3s14h_, d3s14i1, d3s14i2, d3s14j_, d3s14k_, d3s14l_
    automated match to d1twfb_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d3s14b_

PDB Entry: 3s14 (more details), 2.85 Å

PDB Description: rna polymerase ii initiation complex with a 6-nt rna
PDB Compounds: (B:) DNA-directed RNA polymerase II subunit RPB2

SCOPe Domain Sequences for d3s14b_:

Sequence, based on SEQRES records: (download)

>d3s14b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d3s14b_ e.29.1.1 (B:) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlieisfgkiyv
tkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyeaidkvfigrlpimlrsknc
ylseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvae
irsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeile
hicydvndwqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpiakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewg
mepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirek
elkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglve
yidaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiip
fpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrel
pagqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekp
qrtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivd
qvlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdl
iinphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfe
vmynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrf
gemerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkid
iyqihipyaakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d3s14b_:

Click to download the PDB-style file with coordinates for d3s14b_.
(The format of our PDB-style files is described here.)

Timeline for d3s14b_: