Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries) |
Domain d3roaa_: 3roa A: [215949] automated match to d3ro9b_ complexed with 06v, cl, ndp |
PDB Entry: 3roa (more details), 2.3 Å
SCOPe Domain Sequences for d3roaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3roaa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]} kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh
Timeline for d3roaa_: