Lineage for d3ro9b_ (3ro9 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871959Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1871960Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)
  8. 1871966Domain d3ro9b_: 3ro9 B: [193189]
    automated match to d3csea_
    complexed with 06u, ndp

Details for d3ro9b_

PDB Entry: 3ro9 (more details), 2.6 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1006)
PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3ro9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro9b_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

SCOPe Domain Coordinates for d3ro9b_:

Click to download the PDB-style file with coordinates for d3ro9b_.
(The format of our PDB-style files is described here.)

Timeline for d3ro9b_: