Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein automated matches [190514] (10 species) not a true protein |
Species Candida glabrata [TaxId:5478] [193188] (1 PDB entry) |
Domain d3ro9b_: 3ro9 B: [193189] automated match to d3csea_ complexed with 06u, nap |
PDB Entry: 3ro9 (more details), 2.6 Å
SCOPe Domain Sequences for d3ro9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ro9b_ c.71.1.1 (B:) automated matches {Candida glabrata [TaxId: 5478]} kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh
Timeline for d3ro9b_: