Lineage for d3ro9b1 (3ro9 B:3-217)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903757Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2903758Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)
  8. 2903764Domain d3ro9b1: 3ro9 B:3-217 [193189]
    Other proteins in same PDB: d3ro9a2, d3ro9b2
    automated match to d3csea_
    complexed with 06u, ndp

Details for d3ro9b1

PDB Entry: 3ro9 (more details), 2.6 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(pyridin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1006)
PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3ro9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro9b1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

SCOPe Domain Coordinates for d3ro9b1:

Click to download the PDB-style file with coordinates for d3ro9b1.
(The format of our PDB-style files is described here.)

Timeline for d3ro9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ro9b2