SCOPe 2.04: Domain d3roaa_: 3roa A:

Lineage for d3roaa_ (3roa A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)

8. Domain d3roaa_: 3roa A: [215949]
   automated match to d3ro9b_
   complexed with 06v, cl, ndp

Details for d3roaa_

PDB Entry: 3roa, 2.3 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(morpholin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1004)

PDB Compounds: (A:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3roaa_:

Sequence; same for both SEQRES and ATOM records:

>d3roaa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3roaa_:

• d3roaa_ first appeared in SCOPe 2.03
  
• d3roaa_ appears in SCOPe 2.05
  
• d3roaa_ appears in the current release, SCOPe 2.08, called d3roaa1