Lineage for d3reoa1 (3reo A:17-122)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984234Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)
  8. 1984235Domain d3reoa1: 3reo A:17-122 [215776]
    Other proteins in same PDB: d3reoa2, d3reob2, d3reoc2, d3reod2
    automated match to d1kyze1
    complexed with eug, sah

Details for d3reoa1

PDB Entry: 3reo (more details), 1.9 Å

PDB Description: monolignol o-methyltransferase (momt)
PDB Compounds: (A:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3reoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reoa1 a.4.5.0 (A:17-122) automated matches {Clarkia breweri [TaxId: 36903]}
sdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaqlpttnpea
pvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

SCOPe Domain Coordinates for d3reoa1:

Click to download the PDB-style file with coordinates for d3reoa1.
(The format of our PDB-style files is described here.)

Timeline for d3reoa1: