SCOPe 2.06: Domain d3reod1: 3reo D:9-122

Lineage for d3reod1 (3reo D:9-122)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Clarkia breweri [TaxId:36903] [226317] (5 PDB entries)

8. Domain d3reod1: 3reo D:9-122 [233440]
   Other proteins in same PDB: d3reoa2, d3reob2, d3reoc2, d3reod2
   automated match to d3tkyd1
   complexed with eug, sah

Details for d3reod1

PDB Entry: 3reo, 1.9 Å

PDB Description: monolignol o-methyltransferase (momt)

PDB Compounds: (D:) (Iso)eugenol O-methyltransferase

SCOPe Domain Sequences for d3reod1:

Sequence, based on SEQRES records:

>d3reod1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvppsgyispaeiaaq
lpttnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Sequence, based on observed residues (ATOM records):

>d3reod1 a.4.5.0 (D:9-122) automated matches {Clarkia breweri [TaxId: 36903]}
iqiipthssdeeanlfamqlasaavlpmalkaaieldvleimaksvgyispaeiaaqlpt
tnpeapvmldrvlrllasysvvtytlrelpsgkverlyglapvckfltkne

Timeline for d3reod1:

• d3reod1 first appeared in SCOPe 2.03
  
• d3reod1 appears in SCOPe 2.05
  
• d3reod1 appears in SCOPe 2.07
  
• d3reod1 appears in the current release, SCOPe 2.08