|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest | 
|  | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)  duplication contains two domains of this fold | 
|  | Family c.55.1.0: automated matches [227137] (1 protein) not a true family | 
|  | Protein automated matches [226839] (63 species) not a true protein | 
|  | Species Mycobacterium avium [TaxId:1770] [226122] (1 PDB entry) | 
|  | Domain d3r9pa2: 3r9p A:187-387 [215676] automated match to d1g99a2 complexed with edo, gol, pge | 
PDB Entry: 3r9p (more details), 1.9 Å
SCOPe Domain Sequences for d3r9pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r9pa2 c.55.1.0 (A:187-387) automated matches {Mycobacterium avium [TaxId: 1770]}
plrglkqivlhlgngcsasaiagtrpldtsmgltpleglvmgtrsgdidpsivsylchta
gmgvddvesmlnhrsgvvglsgvrdfrrlreliesgdgaaqlaysvfthrlrkyigayla
vlghtdvisftagigendaavrrdavsgmeelgivlderrnlaggkgarqisaddspitv
lvvptneelaiardcvrvlgg
Timeline for d3r9pa2: